Recombinant Proteins

Modified or manipulated proteins encoded by recombinant DNA and suitable for a variety of purposes including the modification of gene sequences, mass protein production, and the manufacture of commercial products.

Search Within Results

10,516 – 10,530 of 121,316 results

10,516

R&D Systems™ Recombinant Human Carbonic Anhydrase VI Protein

Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility.

Pricing & Availability

10,517

Novus Biologicals™ Recombinant Human POP7 His Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability
Specifications

Purity or Quality Grade	>90%, by SDS-PAGE under reducing conditions and visualized by Colloidal Coomassie™ Blue stain
Conjugate	Unconjugated
Gene Alias	0610037N12Rik, EC 3.1.26.5, hPOP7, processing of precursor 7, ribonuclease P subunit, processing of precursor 7, ribonuclease P subunit (S. cerevisiae), processing of precursor 7, ribonuclease P/MRP subunit (S. cerevisiae), ribonuclease P protein subunit p20, Ribonucleases P/MRP protein subunit POP7 homolog, RNaseP protein p20, RPP20S. cerevisiae) homolog
Common Name	POP7
Molecular Weight (g/mol)	TMW: 18.3kDa
Gene ID (Entrez)	10248
Formulation	20mM Tris-HCl buffer (pH 8.0) containing 0.15M NaCl, 50% glycerol, 2mM DTT, 2mM EDTA
Storage Requirements	Store at 4°C short term. Aliquot and store at −20°C long term. Avoid freeze-thaw cycles.
Concentration	0.25mg/mL
For Use With (Application)	SDS-PAGE
Recombinant	Recombinant

10,518

R&D Systems™ Recombinant Cynomolgus Monkey MMP-9 Protein

Recombinant Protein

Pricing & Availability

10,519

R&D Systems™ Recombinant Human CD99-L2 Fc Chimera Protein

Extensive quality control produces lot-to-lot consistency that instills confidence in results and ensures reproducibility.

Pricing & Availability

10,520

R&D Systems™ Recombinant Chicken Caronte Fc Chimera Protein

Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility.

Pricing & Availability

10,521

R&D Systems™ Recombinant Human Laminin alpha 4 Protein

Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility. Applications: Bioactivity

Pricing & Availability

10,522

Novus Biologicals™ ECHDC1 Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability
Specifications

Regulatory Status	RUO
Purification Method	SDS-PAGE
Purity or Quality Grade	>95%
Conjugate	Unconjugated
Common Name	ECHDC1
Storage Requirements	Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
For Use With (Application)	SDS-PAGE
Source	Human

10,523

R&D Systems™ Recombinant Human IFN-alpha 1 (Alpha D [Ala 114]) Protein

Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility. Applications: Bioactivity

Pricing & Availability

10,524

R&D Systems™ Recombinant Mouse IGFBP-1 Protein

Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility. Applications: Bioactivity

Pricing & Availability

10,525

Novus Biologicals™ Recombinant Human SPRED1 His Protein

Highly purified. Generating reliable and reproducible results. Applications: SDS-Page

Pricing & Availability
Specifications

Purity or Quality Grade	>80%, by SDS-PAGE under reducing conditions and visualized by Colloidal Coomassie™ Blue stain
Conjugate	Unconjugated
Gene Alias	EVH1/Sprouty domain containing protein, FLJ33903, hSpred1, NFLS, spred-1, sprouty-related, EVH1 domain containing 1, sprouty-related, EVH1 domain-containing protein 1, suppressor of Ras/MAPK activation
Common Name	SPRED1
Molecular Weight (g/mol)	TMW: 52.9kDa
Gene ID (Entrez)	161742
Formulation	20mM Tris-HCl (pH 8.0) containing 10% glycerol
Storage Requirements	Store at 4°C short term. Aliquot and store at −20°C long term. Avoid freeze-thaw cycles.
Concentration	0.5mg/mL
For Use With (Application)	SDS-PAGE
Recombinant	Recombinant

10,526

Novus Biologicals™ Recombinant Human VPS29 His Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability

10,527

Promotions Available

R&D Systems™ Recombinant Human TRAIL R2/TNFRSF10B Fc Chimera Protein

Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility. Applications: Bioactivity

Pricing & Availability

10,528

Novus Biologicals™ ATG5 Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability
Specifications

Regulatory Status	RUO
Purification Method	SDS-PAGE
Purity or Quality Grade	>85%
Conjugate	Unconjugated
Common Name	ATG5
Molecular Weight (g/mol)	34.6kDa
Formulation	Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 1mM DTT, 40% glycerol, 0.2M NaCl
Storage Requirements	Store at -80°C. Avoid freeze-thaw cycles.
Concentration	0.25mg/mL
For Use With (Application)	SDS-PAGE

10,529

Novus Biologicals™ AASD-PPT Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability
Specifications

Regulatory Status	RUO
Purification Method	Protein
Purity or Quality Grade	>95%
Conjugate	Unconjugated
Common Name	AASD-PPT
Molecular Weight (g/mol)	36.4kDa
Gene ID (Entrez)	60496
Formulation	Liquid. In 20mM Tris-HCl Buffer (pH 8.0) containing 1mM DTT, 10% Glycerol
Immunogen	AASDHPPT, 14-309aa. Sequence: MGSSHHHHHHSSGLVPRGSHMEGVRWAFSCGTWLPSRAEWLLAVRSIQPEEKERIGQFVFARDAKAAMAGRLMIRKLVAEKLNIPWNHIRLQRTAKGKPVLAKDSSNPYPNFNFNISHQGDYAVLAAEPELQVGIDIMKTSFPGRGSIPEFFHIMKRKFTNKEWETIRSFKDEWTQLDMFYRNWALKESFIKAIGVGLGFELQRLEFDLSPLNLDIGQVYKETRLFLDGEEEKEWAFEESKIDEHHFVAVALRKPDGSRHQDVPSQDDSKPTQRQFTILNFNDLMSSAVPMTPEDPSFWDCFCFTEEIPIRNGTKS
Storage Requirements	Store at -80°C. Avoid freeze-thaw cycles.
Concentration	1mg/mL
For Use With (Application)	ELISA,SDS-PAGE
Source	Human

10,530

Promotions Available

R&D Systems™ Recombinant Mouse B7-H4 Fc Chimera Protein

Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility.

Pricing & Availability

Prev
1
...
700
701
702
703
...
8,088
Next

Recombinant Proteins

Filtered Search Results

Narrow Results

Novus Biologicals™ Recombinant Human POP7 His Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ ECHDC1 Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant Human SPRED1 His Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant Human VPS29 His Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ ATG5 Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ AASD-PPT Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant Human POP7 His Protein

Novus Biologicals™ ECHDC1 Protein

Novus Biologicals™ Recombinant Human SPRED1 His Protein

Novus Biologicals™ Recombinant Human VPS29 His Protein

Novus Biologicals™ ATG5 Protein

Novus Biologicals™ AASD-PPT Protein